PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G21770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 484aa    MW: 53578.4 Da    PI: 10.3852
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G21770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.14.3e-10991911495
                      T-EE--HHH.HTT..........---....--SEEEEEETTS-EEEEEE.....EEETTE...EEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3  14 grlvlpkkfaeeh..........ggkke..esktltledesgrsWevkliy...rkksgr...yvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      +rl++p +fa++           ++  +  +   + +  + g++W+v+l+         +    +l++GW e + a+gL eg  vv++l++r  
  OMERI06G21770.1  99 RRLSVPGEFAARLddddaagvgeEE--RgrRAAAVLVVGPLGKVWRVELRRspaGD---GdgeAWLGGGWPELAAAHGLGEGWGVVLRLERRGV 187
                      689*******999999998875522..233667899999**********6645433...2456*************************998766 PP

                      E..EEE CS
               B3  90 felvvk 95 
                      +   ++
  OMERI06G21770.1 188 A--SLR 191
                      6..444 PP

2B341.91.8e-132253081297
                      HTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3  12 ksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                       +  + +p kf+++h  +  +++++  ++  + g+ W+v+l  ++ +  ++l++GW  F  a++L eg +++F+++g++ f  +v vf
  OMERI06G21770.1 225 HLEKMKIPEKFVQQHltETYTNNHQNAIIVCPLGKFWRVEL--QQDQPDVLLRDGWAPFLAAHDLSEGNILLFRYEGNMVF--TVEVF 308
                      334589**********944445667899999**********..999999****************************9999..66665 PP

3B336.58.7e-12393471484
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
               B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                      +++++++  s +l++  +f++++g+ +++ +tl+   ++  sW+v ++ + +  +y+ + GW++F+ +n++kegD ++F  
  OMERI06G21770.1 393 KEMTAYSIHS-LLSVRGTFCSQIGLLEACAITLKTSMKKKGSWRVAFK-TANTYGYINGPGWRKFCLENEVKEGDRLTFNS 471
                      4446666655.69****************9999999999********5.5555579***********************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.6E-1284196IPR015300DNA-binding pseudobarrel domain
CDDcd100173.06E-986186No hitNo description
SuperFamilySSF1019362.16E-1086198IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.3E-588196IPR003340B3 DNA binding domain
PfamPF023621.4E-799188IPR003340B3 DNA binding domain
PROSITE profilePS508639.319100196IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.9E-20212313IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.43E-19213317IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.266214311IPR003340B3 DNA binding domain
CDDcd100178.06E-15215308No hitNo description
SMARTSM010192.5E-6217311IPR003340B3 DNA binding domain
PfamPF023621.1E-10225308IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-14388482IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-13389482IPR015300DNA-binding pseudobarrel domain
CDDcd100172.35E-7390475No hitNo description
SMARTSM010190.028391482IPR003340B3 DNA binding domain
PfamPF023629.6E-9391472IPR003340B3 DNA binding domain
PROSITE profilePS508639.841422484IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MNSERERSRP DQPTSAVSSH RTPSPRSHHS SPVSNHHAQA GSLLAAFTLT LTLTRLAQLP  60
ASSWLSRASP PRPSMPLSAG SLRRRPKFAA PLLSPACLRR LSVPGEFAAR LDDDDAAGVG  120
EEERGRRAAA VLVVGPLGKV WRVELRRSPA GDGDGEAWLG GGWPELAAAH GLGEGWGVVL  180
RLERRGVASL RVFDPGFCLA RFCTPHAGMR TKDRPRFIKL LQQEHLEKMK IPEKFVQQHL  240
TETYTNNHQN AIIVCPLGKF WRVELQQDQP DVLLRDGWAP FLAAHDLSEG NILLFRYEGN  300
MVFTVEVFLQ NGCLKEYKTA ALYLTDGTKG PSNAPQQSAA KVGVSPVKRK RTRRIEGTCL  360
EGPNRKSRAS PISVKVEPQK KHVSIVSQNS FTKEMTAYSI HSLLSVRGTF CSQIGLLEAC  420
AITLKTSMKK KGSWRVAFKT ANTYGYINGP GWRKFCLENE VKEGDRLTFN SIETTIWHVV  480
IVHC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047921e-166AP004792.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0505A04.
GenBankAP0149621e-166AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642658.10.0PREDICTED: putative B3 domain-containing protein Os06g0632500 isoform X1
SwissprotQ67VL70.0Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLA0A0E0E4010.0A0A0E0E401_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g42630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-13B3 family protein